Loading...
Statistics
Advertisement

Seay.ru

Advertisement
Conversion Technology Metas Server
Seay.ru is hosted in Russian Federation . Seay.ru doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/0.6.32.

Technologies in use by Seay.ru

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • nginx/0.6.32

Powered by

  • PHP/5.2.6

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Seay.ru

Missing HTTPS protocol.

    Meta - Seay.ru

    Number of occurences: 1
    • Name:
      Content: 0; URL=http://www-reg.ru

    Server / Hosting

    • IP: 89.111.167.3
    • Latitude: 55.74
    • Longitude: 37.61
    • Country: Russian Federation

    Rname

    • ns1.r01.ru
    • ns2.r01.ru

    Target

    • noc.parkline.ru

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx/0.6.32 Date: Sat, 10 Sep 2016 12:51:01 GMT Content-Type: text/html; charset=cp1251 X-Powered-By: PHP/5.2.6 Set-Cookie: whitex=9a2ebb2da238995a7c697a2dffebe13e; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Content-Length: 190 X-Cache: MISS from s_mf40 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

    DNS

    host: seay.ru
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 89.111.167.3
    host: seay.ru
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: ns1.r01.ru
    host: seay.ru
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: ns2.r01.ru
    host: seay.ru
    1. class: IN
    2. ttl: 21600
    3. type: SOA
    4. mname: ns1.r01.ru
    5. rname: noc.parkline.ru
    6. serial: 2012062402
    7. refresh: 10800
    8. retry: 1800
    9. expire: 604800
    10. minimum-ttl: 21600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.eay.ru, www.seeay.ru, www.eeay.ru, www.sweay.ru, www.weay.ru, www.sdeay.ru, www.deay.ru, www.sxeay.ru, www.xeay.ru, www.sfeay.ru, www.feay.ru, www.sgeay.ru, www.geay.ru, www.steay.ru, www.teay.ru, www.say.ru, www.sxay.ru, www.sesay.ru, www.ssay.ru, www.seway.ru, www.sway.ru, www.seray.ru, www.sray.ru, www.sefay.ru, www.sfay.ru, www.sevay.ru, www.svay.ru, www.secay.ru, www.scay.ru, www.seqay.ru, www.sqay.ru, www.seaay.ru, www.saay.ru, www.seyay.ru, www.syay.ru, www.sey.ru, www.seaoy.ru, www.seoy.ru, www.seapy.ru, www.sepy.ru, www.sea9y.ru, www.se9y.ru, www.seay.ru, www.sey.ru, www.seaiy.ru, www.seiy.ru, www.seauy.ru, www.seuy.ru, www.sea.ru, www.seayz.ru, www.seaz.ru, www.seaya.ru, www.seaa.ru, www.seays.ru, www.seas.ru, www.seayd.ru, www.sead.ru, www.seay.ru, www.sea.ru, www.seayc.ru, www.seac.ru, www.seay .ru, www.sea .ru,

    Other websites we recently analyzed

    1. Ben Brit | Personal Blog
      Scottsdale (United States) - 72.167.183.39
      Server software: Apache
      Technology: CSS, Html, Html5, Php, Pingback, Wordpress
      Number of meta tags: 2
    2. PRODAJA - Pekarska i ugostiteljska oprema nova i polovna, odrzavanje i servisiranje.
      Prodaja pekarske opreme nova i polovna, poslastičarske oprema, servisiranje i odrzavanje pekarsko ugostiteljske opreme.
      Sweden - 194.9.95.45
      Server software: Apache/2.2.31 (FreeBSD) PHP/5.5.33 mod_ssl/2.2.31 OpenSSL/0.9.8zh-freebsd
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 13
      Number of meta tags: 9
    3. IPA - Regionalni klub Karlovac - Naslovnica
      policijska udruga
      San Francisco (United States) - 199.34.228.100
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 7
      Number of meta tags: 3
    4. SZEOB
      Hungary - 92.43.203.26
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Javascript, Php, Joomla
      Number of Javascript: 18
      Number of meta tags: 2
    5. HADI Maschinenbau GesmbH - Maschinen für die Akkumulatoren-Industrie
      Maschinen für die Akkumulatoren-Industrie - Machines for the accumulator industry
      Austria - 213.145.228.64
      Server software: Apache/1.3.34
      Technology: CSS, Html, Javascript, Php, Swf Object
      Number of Javascript: 1
      Number of meta tags: 5
    6. Nicolaasparochie Amsterdam
      Netherlands - 188.93.150.44
      Server software: Apache/2.2.16 (Debian)
      Technology: CSS, Html, Javascript, jQuery UI, Php, Facebook Box
      Number of Javascript: 12
      Number of meta tags: 3
    7. Common Thread Ministries - Home
      Houston (United States) - 192.254.236.52
      Server software: nginx/1.10.1
      Technology: CSS, Google Font API, Html, Html5
      Number of Javascript: 2
      Number of meta tags: 1
    8. kinderopvangwatergraafsmeer.amsterdam
      Netherlands - 188.93.150.35
      Server software: Apache/2.4.10
      Technology: Html
    9. wvpp.net
      Ottawa (Canada) - 47.90.14.232
      Server software: Microsoft-IIS/7.5
      Technology: Html, Php
      Number of Javascript: 1
      Number of meta tags: 1
    10. postoakfinancialadvisors.com
      Scottsdale (United States) - 50.63.202.65
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe

    Check Other Websites